DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and si:dkey-21e2.14

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_003201094.1 Gene:si:dkey-21e2.14 / 100034620 ZFINID:ZDB-GENE-050208-699 Length:251 Species:Danio rerio


Alignment Length:240 Identity:73/240 - (30%)
Similarity:116/240 - (48%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPE 102
            ||.|........|:.|||:        |...|:|||::|::..|.:||||          :::.:
Zfish    26 IVDGREAKPHSRPYMVSVQ--------YYEQHICGGSLITEEFVLTAAHC----------WKESD 72

  Fly   103 LYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPW-ESPGVRAIPLAI 166
            :..||.|:..:.: |:....:.|...:.|.|||.:||.||:.||.|...:.. ::.|:.::|...
Zfish    73 ILTVVVGAHDLSK-DKMYNSFEVASYLPHPDYNSNTLGNDLMLLKLKEKVRLSDNVGLISLPKDG 136

  Fly   167 KAPEEGTTCLIHGWGKVTMK-EKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDAC 228
            :..|..|.|.:.|||.:.|. ..|..|.:|...|:....|:..:  ...||::...:..||  :|
Zfish   137 EDVEADTHCSVAGWGTLWMNGPVSDRLMEAETVIMYDAECERRWGSDYMASKLICVYGYGG--SC 199

  Fly   229 QGDSGGPLICDGRLAGIISWG--VGCADPGYPGVYTNVSHFLKWI 271
            .|||||||:|.....|:.|:.  ..|.....|.|||.:|.:||||
Zfish   200 IGDSGGPLVCGVTAVGVTSYSDHYLCNSRLLPNVYTRISAYLKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/238 (30%)
Tryp_SPc 38..273 CDD:238113 73/240 (30%)
si:dkey-21e2.14XP_003201094.1 Tryp_SPc 26..245 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.