DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and plaua

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:278 Identity:96/278 - (34%)
Similarity:143/278 - (51%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ||:||...|::..|:..::.:        |.|.:|||.:|:...|.:||||:.......:     
Zfish   163 KIIGGLRSTVESQPWMAAIFK--------GDGFICGGTLITPCWVLTAAHCFPTGKRTQI----- 214

  Fly   102 ELYVVVAGSSAIDRTDRF-TQEYLVQRIVGHKDYNGSTLEN---DIALLFL---NGFIPWESPGV 159
            ..|.||.|.:||:.||.. .|::.|.|:|.|:|::.|| ||   |||||.:   ||....::..|
Zfish   215 NRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDFDYST-ENYTHDIALLKIEDCNGQCAVKTKTV 278

  Fly   160 R--AIPLAIKAPEEGTTCLIHGWG---KVTMKEKSASLQQAPVPILNKELCQVIY----KLPASQ 215
            |  .:|...:....|..|.|.|:|   |.|.| .|..|:|..|.::::::||..|    ::..:.
Zfish   279 RTACLPPFQQMLPVGFYCEIAGYGRYQKGTFK-FSRYLKQTEVKLISQKVCQRTYYNKDEVNENM 342

  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANA 276
            :||.......|||||||||||:|:..    |.||||||..||:...|||||.||::.:||     
Zfish   343 LCANGRDWKTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPGVYTQVSNYNQWI----- 402

  Fly   277 SLDYSEYRQIPPLNLASR 294
                |::..:|.....||
Zfish   403 ----SQHTGLPRYTAGSR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/253 (36%)
Tryp_SPc 38..273 CDD:238113 91/254 (36%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.