DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and tmprss3a

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:307 Identity:102/307 - (33%)
Similarity:150/307 - (48%) Gaps:59/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 THSGITQSQIGQPT-----ATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            |:|..|:..:|..|     |..|......:||||......|.|:|||:        |:...|:||
Zfish   268 TNSSKTKCSLGMVTALKCIACGSRPKFSARIVGGNLSAEGQFPWQVSL--------HFQNEHLCG 324

  Fly    73 GAVISQRVVCSAAHC-YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNG 136
            |::|:.|.:.:|||| |.|      .|  |..::|.||.:.:..  ...:.:.|::|:.|..|..
Zfish   325 GSIITSRWILTAAHCVYGI------AY--PMYWMVYAGLTELPL--NAVKAFAVEKIIYHSRYRP 379

  Fly   137 STLENDIALLFL------NGFIPWESPGVRAIPLAI----KAPEEGTTCLIHGWGKVTMKEKSAS 191
            ..|::||||:.|      ||.:.         |:.:    :..|:|..|.|.||| .|.....||
Zfish   380 KGLDHDIALMKLAQPLTFNGMVE---------PICLPNFGEQFEDGKMCWISGWG-ATEDGGDAS 434

  Fly   192 LQQ--APVPILNKELCQ--VIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDG----RLAGII 246
            :.|  |.||:::.:.|.  .:|:  |.|..:|||:|.||.|:|||||||||.|:.    :|.|..
Zfish   435 VSQHCASVPLISNKACSQPEVYQGYLTAGMICAGYLDGGTDSCQGDSGGPLACEDSSIWKLVGAT 499

  Fly   247 SWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQIPPLNLAS 293
            |||.|||:...|||||.::..|.||.     |.......:.||.::|
Zfish   500 SWGQGCAEKNKPGVYTRITQSLTWIH-----LQMEREEILHPLTVSS 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/254 (35%)
Tryp_SPc 38..273 CDD:238113 91/255 (36%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 7/23 (30%)
Tryp_SPc 298..525 CDD:238113 90/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.