DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and NIT2

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_012409.1 Gene:NIT2 / 853316 SGDID:S000003662 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:40/196 - (20%)
Similarity:73/196 - (37%) Gaps:41/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SLFKRDFYTAGVVEFEPSNELSDNLAGYLEIIQSQNATSTDIIVFPESTLNSAGSTTFVPNPEDQ 90
            |..||    ..|.:...|.:|:.||....|:|........|::              |:|...|.
Yeast     3 SKLKR----VAVAQLCSSADLTKNLKVVKELISEAIQKKADVV--------------FLPEASDY 49

  Fly    91 I--NPC----LSDPNATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVF 149
            :  ||.    |:..:..:..:...:::...|:.|:.|.:::.     ..:|...:........|.
Yeast    50 LSQNPLHSRYLAQKSPKFIRQLQSSITDLVRDNSRNIDVSIG-----VHLPPSEQDLLEGNDRVR 109

  Fly   150 NTNVVFDRQGVVVSRYRKVHLYG-EPKNSTFLPELST----------FETDFGVTFGHFICFDIL 203
            |..:..|.:|.::..|:|:||:. :..|...|.|..:          .|:..| ..|..||:||.
Yeast   110 NVLLYIDHEGKILQEYQKLHLFDVDVPNGPILKESKSVQPGKAIPDIIESPLG-KLGSAICYDIR 173

  Fly   204 F 204
            |
Yeast   174 F 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 37/189 (20%)
Vanin_C 324..503 CDD:408788
NIT2NP_012409.1 nit 7..302 CDD:143596 38/192 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.