DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and NIT1

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_005245271.1 Gene:NIT1 / 4817 HGNCID:7828 Length:344 Species:Homo sapiens


Alignment Length:118 Identity:33/118 - (27%)
Similarity:53/118 - (44%) Gaps:27/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VFNTNVVFDRQGVVVSRYRKVHLY-----GE----PKNSTFL-PEL-STFETDFGVTFGHFICFD 201
            ::|.:|:.:.:|.||:.|||.||.     |:    ..|||.. |.| |...|..| ..|..:|:|
Human   159 IYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAG-KIGLAVCYD 222

  Fly   202 ILFYTPAHQLIVEQ-GITDFVYPAMWFSQLPFLTVNG------IFSSKAVQIQ 247
            :.|  |...|.:.| |.....||:      .|.::.|      :..::|::.|
Human   223 MRF--PELSLALAQAGAEILTYPS------AFGSITGPAHWEVLLRARAIETQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 33/118 (28%)
Vanin_C 324..503 CDD:408788
NIT1XP_005245271.1 nit 65..332 CDD:143596 33/118 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.