DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and pyd3

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_649732.1 Gene:pyd3 / 40916 FlyBaseID:FBgn0037513 Length:386 Species:Drosophila melanogaster


Alignment Length:229 Identity:52/229 - (22%)
Similarity:81/229 - (35%) Gaps:70/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NGLNVFNTNVVFDRQGVVVSRYRKVHL--YGEPKNSTFLPELST----FETDFGVTFGHFICFDI 202
            :|..::||.||....|..:.::||.|:  .|:...||:..|.:|    |||:|| .....||:. 
  Fly   174 HGETIWNTAVVISNSGRYLGKHRKNHIPRVGDFNESTYYMEGNTGHPVFETEFG-KLAVNICYG- 236

  Fly   203 LFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTVNG---IFSSKAVQIQLG---WSYANNVNLLAA 261
                 .|            :|..|.    ...:||   :|:..|...:|.   ||..        
  Fly   237 -----RH------------HPQNWM----MFGLNGAEIVFNPSATIGRLSEPLWSIE-------- 272

  Fly   262 GASDPIVGNSGSGIYHGRSGSLRSVMRQESGE------------RSIYVA-----RVPKYRAKR- 308
             |.:..:.||...:...|.|:.:......||:            .|.|||     |.|.....: 
  Fly   273 -ARNAAIANSYFTVPINRVGTEQFPNEYTSGDGNKAHKEFGPFYGSSYVAAPDGSRTPSLSRDKD 336

  Fly   309 -----RMKRDLKRQVATSSSFNIKRD---YLENF 334
                 .:..:|.|||.....|.:.:.   |.|:|
  Fly   337 GLLVVELDLNLCRQVKDFWGFRMTQRVPLYAESF 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 49/219 (22%)
Vanin_C 324..503 CDD:408788 4/14 (29%)
pyd3NP_649732.1 PLN00202 9..385 CDD:177792 52/229 (23%)
ML_beta-AS 9..372 CDD:143611 52/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.