DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and upb1

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_955910.1 Gene:upb1 / 322660 ZFINID:ZDB-GENE-030131-1380 Length:384 Species:Danio rerio


Alignment Length:313 Identity:65/313 - (20%)
Similarity:110/313 - (35%) Gaps:71/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EIIQSQNATSTDIIVFPES--------TLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLS 111
            |:::.......:|:.|.|:        |......|.|..:.||.:.           ..|.:.| 
Zfish   102 EMVEVAAMCGVNIVCFQEAWTMPFAFCTREREPWTEFAESAEDGLT-----------TRFCIQL- 154

  Fly   112 CAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHL--YGEP 174
              |:..:..:|..:.|:.:.            :|..::||.||....|.|:.:.||.|:  .|:.
Zfish   155 --AKKHNMVVVSPILERDEI------------HGGTLWNTAVVVSNNGNVLGKTRKNHIPRVGDF 205

  Fly   175 KNSTFLPELST----FETDFG-----VTFGHFICFDILFYT-PAHQLIVEQGIT-DFVYPAMWFS 228
            ..||:..|.:|    |:|.||     :.:|.....:.|.|: ...::|.....| ..:...||  
Zfish   206 NESTYYMEGNTGHRVFQTQFGKIAVNICYGRHHPLNWLMYSVNGAEIIFNPSATVGLLSEPMW-- 268

  Fly   229 QLPFLTVNGIFSSKAVQI---QLGWSYANNVNLLAAGASDPIVGNSGSGIYHGRS---GSLRSVM 287
              |....|...::.....   ::|..|..|          ......|...:|...   ||  |.|
Zfish   269 --PIEARNAAIANHCFTCAINRVGTEYFKN----------EFTSGDGKKAHHDFGHFYGS--SYM 319

  Fly   288 RQESGERSIYVARVPKYRAKRRMKRDLKRQVATSSSFNIKRDYLENFTSEELK 340
            ....|.|:..::|.........:..:|.||||...:|.:...|  ...:||||
Zfish   320 AAPDGSRTPGLSRTRDGLLVAELDLNLNRQVADKWNFKMTGRY--EMYAEELK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 60/300 (20%)
Vanin_C 324..503 CDD:408788 6/17 (35%)
upb1NP_955910.1 PLN00202 6..384 CDD:177792 65/313 (21%)
ML_beta-AS 9..371 CDD:143611 65/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.