DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Nit1

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_036179.1 Gene:Nit1 / 27045 MGIID:1350916 Length:323 Species:Mus musculus


Alignment Length:227 Identity:47/227 - (20%)
Similarity:79/227 - (34%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSC----------AARNASKYIVINLT 126
            |..|.:....|..||.::....|     |...:|.....:|          .|||.::.::::  
Mouse    41 ELPLVAVCQVTSTPNKQENFKTC-----AELVQEAARLGACLAFLPEAFDFIARNPAETLLLS-- 98

  Fly   127 EKQKCEDIPED--------TRPCA---------------SNGLNVFNTNVVFDRQGVVVSRYRKV 168
                 |.:..|        .|.|.               .....::|.:|:.:.:|.||:.|||.
Mouse    99 -----EPLNGDLLGQYSQLARECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKGSVVASYRKT 158

  Fly   169 HL-------YGEPKNSTFLPELSTFE----TDFGVTFGHFICFDILFYTPAHQL-IVEQGITDFV 221
            ||       .|..:.|.:.....|.|    |..| ..|..||:|:.|  |...| :.:.|.....
Mouse   159 HLCDVEIPGQGPMRESNYTKPGGTLEPPVKTPAG-KVGLAICYDMRF--PELSLKLAQAGAEILT 220

  Fly   222 YPAMWFSQLPFLTVNG------IFSSKAVQIQ 247
            ||:      .|.:|.|      :..::|::.|
Mouse   221 YPS------AFGSVTGPAHWEVLLRARAIESQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 47/227 (21%)
Vanin_C 324..503 CDD:408788
Nit1NP_036179.1 nit 44..311 CDD:143596 46/224 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.