DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and upb-1

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_495261.1 Gene:upb-1 / 174040 WormBaseID:WBGene00017440 Length:387 Species:Caenorhabditis elegans


Alignment Length:236 Identity:53/236 - (22%)
Similarity:83/236 - (35%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VFNTNVVFDRQGVVVSRYRKVHL--YGEPKNSTFLPELS----TFETDFGVTFGHFICFDILFYT 206
            ::||.||....|.|:.|.||.|:  .|:...||:..|.:    .|||.:| ..|..||:.     
 Worm   179 IWNTAVVISHTGRVIGRSRKNHIPRVGDFNESTYYMESTLGHPVFETKYG-RIGINICYG----- 237

  Fly   207 PAHQLIVEQGITDFVYPAMWFSQLPFLTVNG---IFSSKAVQIQLG---W-------SYANNV-- 256
             .|            :|..|.    ...:||   ||:..|....|.   |       :.||:|  
 Worm   238 -RH------------HPQNWM----MYALNGAEIIFNPSATVGALSEPLWGIEARNAAIANHVFT 285

  Fly   257 ------------NLLAAGASDPIVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRAKRR 309
                        |...:|...|  .:...|.::|     .|.:....|.|:..::||.:......
 Worm   286 VGINRVGTEVFPNEFTSGNGQP--AHKDFGHFYG-----SSYIAAPDGSRTPALSRVREGVLIAE 343

  Fly   310 MKRDLKRQVATSSSFNIKRDYLENFTSEELKIDAGKIGNLS 350
            :..:|.||...:..|.:         :..|.:.|.||..:|
 Worm   344 LDLNLCRQCKDAWGFRM---------TNRLDMYAQKITEVS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 48/213 (23%)
Vanin_C 324..503 CDD:408788 6/27 (22%)
upb-1NP_495261.1 ML_beta-AS 11..373 CDD:143611 52/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.