DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and MAK16

DIOPT Version :9

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_115898.2 Gene:MAK16 / 84549 HGNCID:13703 Length:300 Species:Homo sapiens


Alignment Length:353 Identity:165/353 - (46%)
Similarity:217/353 - (61%) Gaps:72/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQHDDVVWSII-NKSFCSHKVKTDTRTFCRHEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFI 64
            ||.|||:|..: ||.|||.|::|.|::|||:||:|||||.|.:||||||||||::||||..||::
Human     1 MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYM 65

  Fly    65 KTAERAHMPSKLWERIKLSRNFEKAIEQINENLVFWPKYMIAKNKQRFLKITQYLIRMRRLKLRR 129
            |..|||..|.:||||::||:|:|||:|||:|||::||:::..|.||||.||||||||:|:|.|:|
Human    66 KVIERAAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYLIRIRKLTLKR 130

  Fly   130 QKLIVPLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTYRDIYNFSQTAFNKALEAERV 194
            |:.:||||.|:||||.|||||||:||::||.|||.|::|||..||.|||||...||:||||    
Human   131 QRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALE---- 191

  Fly   195 DEDDEEELDDEDENEEQLEREMEVDGDDSREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDED 259
                                                     ::..|:|:.|.||.||||||::  
Human   192 -----------------------------------------QQEAESDSSDTEEKDDDDDDEE-- 213

  Fly   260 DYDSDSGKREEVEVG-------SDFEE-------SDEDDDADADDIEETKVPAKKTASKAKKDKK 310
                |.||||.||.|       ||||:       ||||.|..:...||    .:|..|...|.|.
Human   214 ----DVGKREFVEDGEVDESDISDFEDMDKLDASSDEDQDGKSSSEEE----EEKALSAKHKGKM 270

  Fly   311 SPAGNSRRSRSKPKLQLEYEYEVEKEAQ 338
            ...|..:|.|:  .:::|||.|.|..|:
Human   271 PLRGPLQRKRA--YVEIEYEQETEPVAK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 122/224 (54%)
Ribosomal_L28e 6..115 CDD:280030 65/109 (60%)
Mak16 139..241 CDD:282698 36/101 (36%)
MAK16NP_115898.2 PLN00040 1..196 CDD:215038 122/239 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..278 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144348
Domainoid 1 1.000 162 1.000 Domainoid score I4001
eggNOG 1 0.900 - - E1_COG5129
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2764
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54003
OrthoDB 1 1.010 - - D1394336at2759
OrthoFinder 1 1.000 - - FOG0004909
OrthoInspector 1 1.000 - - oto91801
orthoMCL 1 0.900 - - OOG6_102084
Panther 1 1.100 - - LDO PTHR23405
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.