DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and thoc7

DIOPT Version :9

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_728489.2 Gene:thoc7 / 38033 FlyBaseID:FBgn0035110 Length:288 Species:Drosophila melanogaster


Alignment Length:251 Identity:54/251 - (21%)
Similarity:97/251 - (38%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 IKLSRNFEK-AIEQINENLVFWPKYM--IAKNKQRFLKITQYLIRM-------RRLKLRRQKLIV 134
            :.|.:.|.| |.:.::.|.:.:.:.|  .|:.|...||..|.|..:       .:|....::.||
  Fly    45 VVLLKQFLKWASDSLDSNPIMYDRLMAQFAQCKLTALKNVQTLQMIAGERDNYTQLVEHHEESIV 109

  Fly   135 PLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTYRDIYNFSQTAFNKALEAERVDEDDE 199
                 :.:.|....:|.|:.||   .|.|..|:      |..:.:..|...::: |.:|..|...
  Fly   110 -----LAKAEIESSKKELITAK---QIRKNKME------YDLLASLIQDQPDRS-ETQRHIETIR 159

  Fly   200 EELDDEDENEEQLER-------------------EMEVDGDDSREAEEVQRSLLDEEFVEADTDD 245
            .|:||..:.:.::||                   |.::|.|.|..|..          ..:|.|.
  Fly   160 REIDDLVQKKLKMERKFQKRRNDFTLLMYTIHELEQQLDQDSSSSASS----------SSSDCDA 214

  Fly   246 EEEDDDDDD-----DDDEDDYDSDSGKREEVEVGSDFEESDEDDDADADDIEETKV 296
            ..|.|.||:     .|::||.::.:..:.:...|.....|...:|:.|..:||..|
  Fly   215 RSEPDLDDNGIMEVSDEDDDLNNSTPTKFDGARGEPKYHSVSTEDSKAMSVEEDTV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 37/173 (21%)
Ribosomal_L28e 6..115 CDD:280030 9/37 (24%)
Mak16 139..241 CDD:282698 23/120 (19%)
thoc7NP_728489.2 THOC7 24..152 CDD:283305 26/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.