DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32727 and AT5G03030

DIOPT Version :10

Sequence 1:NP_727185.1 Gene:CG32727 / 318176 FlyBaseID:FBgn0265265 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001331589.1 Gene:AT5G03030 / 831703 AraportID:AT5G03030 Length:152 Species:Arabidopsis thaliana


Alignment Length:122 Identity:40/122 - (32%)
Similarity:55/122 - (45%) Gaps:25/122 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SDYLPLVSTVVAVGVATCCVAA-------QIFRSPNSTKTIGQLRLCFGNLGTGRFYSGCFQKRM 68
            |.|......:....||...||.       |.|:   :...:.::|         |||.|.||..|
plant    37 SGYTQATPMIAGAAVAAAAVAGRYGILAWQAFK---ARPRVPRMR---------RFYEGGFQSSM 89

  Fly    69 SHREASKILSI--SPNAPWI----RRAMLAKHPDRNGSPYLAGKIHKPKNGLLEGRN 119
            :.|||:.||.:  |..|..:    ||.|:|.|||..||.|||.||::.|:.:|...|
plant    90 TRREAALILGVRESVVADKVKEAHRRVMVANHPDAGGSHYLASKINEAKDMMLGKSN 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32727NP_727185.1 DnaJ <34..115 CDD:413365 31/86 (36%)
AT5G03030NP_001331589.1 DnaJ <84..143 CDD:413365 25/58 (43%)

Return to query results.
Submit another query.