DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uros1 and Uros2

DIOPT Version :9

Sequence 1:NP_001259362.1 Gene:Uros1 / 31817 FlyBaseID:FBgn0030066 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650489.1 Gene:Uros2 / 41908 FlyBaseID:FBgn0038361 Length:253 Species:Drosophila melanogaster


Alignment Length:253 Identity:106/253 - (41%)
Similarity:145/253 - (57%) Gaps:2/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLDELRAKLQNPDKYAGIIFTS 65
            |..|.:..:|......|.|.|...|..|:.:|:|:....|.||||.:|:|||..|.|||||||.|
  Fly     1 MGDRNKQPVILLKVPSSDDFYGSALRSHNLDPIFITPSHFVFKNLKQLQAKLHEPHKYAGIIFAS 65

  Fly    66 PRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARALGDYIVDTFD 130
            ||||:||.|:|....||..|:.||||::|:.||:.|..|...|.|.|....||..|.|.||:||.
  Fly    66 PRCVQAVNEALGKTPLPSCWRALHNYSLGKNTHSAAWITFQNLPTLGDHAVNANNLCDLIVETFG 130

  Fly   131 GSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVERALEIYGESIEFLAFF 195
            ..|.||||:||||....||..:|...||.||||||||:|.||:....:..||:.  :.:|.:.||
  Fly   131 PKRDLPLLMPCGNGVGQTLRLRLVAQGFRVDACEVYESRSHPDFVNQMRHALKF--KRMETIVFF 193

  Fly   196 SPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESLGQKVYCTAERPTVEHLVKVL 253
            .||.|..:.::|.:..:|:...||:|:|..||:|:|..|.|.........|:.|:.::
  Fly   194 GPSSVRSSLEFFGNYNVSLKDRKLIAVGSGTRKAMEESGIKADGVVNAADVDRLINII 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uros1NP_001259362.1 HEM4 20..251 CDD:280722 101/230 (44%)
Uros2NP_650489.1 HemD 9..251 CDD:119440 104/243 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454583
Domainoid 1 1.000 115 1.000 Domainoid score I5984
eggNOG 1 0.900 - - E1_COG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4761
Isobase 1 0.950 - 0 Normalized mean entropy S4099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557657at2759
OrthoFinder 1 1.000 - - FOG0005207
OrthoInspector 1 1.000 - - otm26442
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4829
1110.850

Return to query results.
Submit another query.