DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32713 and UBL4A

DIOPT Version :10

Sequence 1:NP_727264.1 Gene:CG32713 / 318166 FlyBaseID:FBgn0052713 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_055050.1 Gene:UBL4A / 8266 HGNCID:12505 Length:157 Species:Homo sapiens


Alignment Length:166 Identity:43/166 - (25%)
Similarity:71/166 - (42%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQVLVQTRDGKKTVYEVDRLGTVASLKARIGQVMSVPMGFSRLSYKGRVLSNQSVLED--LGPNK 66
            :|:.|:...|::...:|.....|::||..:.:.::||:...||.:||:.|::...|.|  :||| 
Human     1 MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPN- 64

  Fly    67 STLDLTWKP---VVLTANQSSKLSKFGYGRIDDSEVMFTLIGGYQQREEYPGGLVNPPDDESQL- 127
            |.|:|..||   |:|...::.:|:        ||                      ||....|| 
Human    65 SKLNLVVKPLEKVLLEEGEAQRLA--------DS----------------------PPPQVWQLI 99

  Fly   128 ------NFNAGDDDDALE-AQDMTGHDLSSIQTDDL 156
                  :|:|.|....|| .|......||.:..||:
Human   100 SKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32713NP_727264.1 Ubl_ubiquitin_like 6..71 CDD:340559 20/66 (30%)
UBL4ANP_055050.1 Ubl_UBL4A_like 1..72 CDD:340505 22/71 (31%)
Tugs 96..142 CDD:465528 12/40 (30%)
Required and sufficient for interaction with BAG6. /evidence=ECO:0000269|PubMed:25535373, ECO:0000269|PubMed:25713138 96..138 12/40 (30%)

Return to query results.
Submit another query.