DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moe and inavaa

DIOPT Version :9

Sequence 1:NP_727290.1 Gene:Moe / 31816 FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_009302242.1 Gene:inavaa / 567844 ZFINID:ZDB-GENE-081105-161 Length:596 Species:Danio rerio


Alignment Length:259 Identity:56/259 - (21%)
Similarity:94/259 - (36%) Gaps:78/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 PD--TIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQEDMERSQRDLL 431
            ||  |..|:::....|..:..:|...::|:|.:...::...::.|...:|.        |...||
Zfish    22 PDSPTSPVKELNTHTRAMRLKQQALEDRLELCVLELKKLCIREAELTGKLP--------SDYPLL 78

  Fly   432 --EAQDMIRR-------LEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKLEEEIM 487
              |....:||       |:|..  :....:|.||...|....|||    :..||..||.|||.| 
Zfish    79 PDEKPPQVRRRIGAAFKLDEGF--ISQDGEESELLSLEADLALQR----QIYEAARKLSLEEHI- 136

  Fly   488 AKQMEVQRIQDEVNAKDEETKRLQDEV--------------------------EDARRKQVIA-- 524
            :|.:...|:| :...::::.|.||..:                          :|:.....:|  
Zfish   137 SKPVRKSRLQ-QCKREEKKLKELQVAILKHRINHGCVSPQTCYSSRQRDLCMSDDSSLSDAVALD 200

  Fly   525 -----AEAAAALLAASTTPQHHHVAEDENENEEELT----NGDAGGDVSRDLDTDEHIKDPIED 579
                 |..:.|:|.:||           :...:.||    ||......|..||.|   ..||::
Zfish   201 DDSDSAPFSPAVLGSST-----------DSGFQRLTLLPKNGPKQSSSSSSLDYD---ASPIQN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604
FERM_N 28..83 CDD:286467
FERM_M 163..278 CDD:278785
FERM_C_ERM 272..368 CDD:270015
GBP_C <375..497 CDD:303769 31/130 (24%)
ERM 403..649 CDD:279153 48/223 (22%)
coiled coil 464..477 CDD:293879 4/12 (33%)
coiled coil 486..497 CDD:293879 3/10 (30%)
inavaaXP_009302242.1 DUF3338 4..138 CDD:314652 33/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.