DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Moe and inavab

DIOPT Version :9

Sequence 1:	NP_727290.1	Gene:	Moe / 31816	FlyBaseID:	FBgn0011661	Length:	649	Species:	Drosophila melanogaster
Sequence 2:	NP_001073474.1	Gene:	inavab / 563192	ZFINID:	ZDB-GENE-061103-190	Length:	612	Species:	Danio rerio

Alignment Length:	136	Identity:	33/136 - (24%)
Similarity:	56/136 - (41%)	Gaps:	44/136 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   408 KQQEYEDRLKQMQEDMER-------------SQRDLL--EAQDMIRR-------LEE-------Q 443
            |||..|||||....::::             |...||  |....|||       |:|       :
Zfish    40 KQQSLEDRLKMCLVELKKLCIREAELTGHLSSVYPLLPGEKPPQIRRRIGAAFKLDEPSILHRTE 104

  Fly   444 LKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETK 508
            ...|.:.:.:|.| |:::....|||             .:||.::|.::..|:| :...::.:.|
Zfish   105 NSALSSVEADLAL-QQQIYVAAQRL-------------CQEEHLSKGVKRSRLQ-QYQREERKLK 154

  Fly   509 RLQDEV 514
            .||:.|
Zfish   155 DLQEAV 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Moe	NP_727290.1	B41	26..278	CDD:214604
		FERM_N	28..83	CDD:286467
		FERM_M	163..278	CDD:278785
		FERM_C_ERM	272..368	CDD:270015
		GBP_C	<375..497	CDD:303769	28/117 (24%)
		ERM	403..649	CDD:279153	33/136 (24%)
		coiled coil	464..477	CDD:293879	3/12 (25%)
		coiled coil	486..497	CDD:293879	2/10 (20%)
inavab	NP_001073474.1	DUF3338	8..136	CDD:288652	26/109 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3529
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900