DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moe and sstn

DIOPT Version :9

Sequence 1:NP_727290.1 Gene:Moe / 31816 FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster


Alignment Length:332 Identity:65/332 - (19%)
Similarity:118/332 - (35%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 QDDRLTPKIGFPWSEIRNIS----FSEKKFIIKPIDKKAPD--------------FMFFAPRVRI 348
            :||   ||:.....|.|..:    .|||.::::.|.|:...              |:..|.:.:.
  Fly    53 EDD---PKVRKENLEARKQALEQRLSEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLAQQYKH 114

  Fly   349 NKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYE 413
            .:::.||...|..:.  |||..|...:...:|.....|.:|.            |....:..||:
  Fly   115 EQQLQALARENSSIL--RRKQSTTSRESRDSQMTINNNNRQS------------ETLSNRSSEYD 165

  Fly   414 DRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQL-QAAKDELELRQKELQAMLQRLEEAKNMEAV 477
            :    .|........|:|    :|...::|.:|. ...|..|:.|.....:.:|.:.:....:| 
  Fly   166 N----YQPSSSAGAGDML----VIGVAQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQQHQQQA- 221

  Fly   478 EKLKLEEEIMAKQMEVQRIQDEV----NAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTP 538
                    .:|..|..||.|.:|    :|.......|:...:.|.::|.|..:.....|    :|
  Fly   222 --------HLAMNMNYQRSQPDVISMYSANSSNVATLRQPPQVAPQQQPIIVQCDKYYL----SP 274

  Fly   539 QHHHVAEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLA-----ERNERLHD-QLKAL 597
            .|      ::.||        ||.:....:..::: .|:.....::     :||...|. ||.|:
  Fly   275 TH------QSYNE--------GGFIKSSQNIKKYV-SPMASPSNISYEQQQQRNPLHHQRQLDAI 324

  Fly   598 KQDLAQS 604
              .||.|
  Fly   325 --SLAPS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604
FERM_N 28..83 CDD:286467
FERM_M 163..278 CDD:278785
FERM_C_ERM 272..368 CDD:270015 17/83 (20%)
GBP_C <375..497 CDD:303769 21/122 (17%)
ERM 403..649 CDD:279153 42/213 (20%)
coiled coil 464..477 CDD:293879 1/12 (8%)
coiled coil 486..497 CDD:293879 4/10 (40%)
sstnNP_648745.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.