DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr98a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:373 Identity:75/373 - (20%)
Similarity:136/373 - (36%) Gaps:105/373 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLSSTFLVLILIELVG-----------EIETYFTEENPDNESVPAYFAKVIMGVNMAYKMIHAWI 83
            |.|..|..::|...:|           |.:..|..:...:....:.|..:::|        ||.|
  Fly    32 LFSKGFCYVLLFVSLGFSSYWRFSFDYEFDYDFLNDRFSSTIDLSNFVALVLG--------HAII 88

  Fly    84 ALSALF-EC-----RRFRYLLEELPPVKATS-----------FIYRHLILEIILFACNAFLVLSE 131
            .|..|: .|     |:.:.:..::.....||           :||..||:..::     |:|::.
  Fly    89 VLELLWGNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRRYCNWIYGSLIIRWLI-----FIVVTI 148

  Fly   132 YTIRGIYLENLRYAYSLQAVRARYLQM-----MVLVDRLDGKLEQLHHRVISGSSD-----YKT- 185
            |:.|.:   .:...||.....||:.:.     ::|.         ::..:|.|.|:     |:| 
  Fly   149 YSNRAL---TINATYSELVFLARFSEFTLYCAVILF---------IYQELIVGGSNVLDELYRTR 201

  Fly   186 ------LRLDYAHLAKV----------TRSLSHLFGLSLLLL------NVLCLGDWIIVCNVYFM 228
                  .||....|||:          .|.|...|.|||:.|      :...|..|:.:..|...
  Fly   202 YEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHT 266

  Fly   229 VAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVER----- 288
            ...:|...||         |.|..|::|...|....||.:    :|::...:......:|     
  Fly   267 RVAVQHYVAT---------VECIKLLEIVVPCYLCTRCDA----MQRKFLSMFYTVTTDRRSSQL 318

  Fly   289 -SQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335
             :.:....||:.|:..:....|:..:|.:.|...||.::..:||.:||
  Fly   319 NAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 73/371 (20%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 75/373 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.