DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr66a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:413 Identity:73/413 - (17%)
Similarity:126/413 - (30%) Gaps:163/413 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDN--------ESVPAYFAKVIMGVNMAY 76
            |....|.:||.:....::.::.||...:.||....:...        .::|.:       :|...
  Fly   132 CVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTF-------INTLD 189

  Fly    77 KMIHAWIALSALFECRRFRYL---LEEL------------------PPVKATSFIYRHLILEIIL 120
            |:   |.|:|......||..:   ||||                  ||:.::.            
  Fly   190 KI---WFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQ------------ 239

  Fly   121 FACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDG-KLEQLHHRVISGSSDYK 184
                          ...|..||.|.|.                .|.| .:..:....:|||...|
  Fly   240 --------------PPQYDSNLEYLYK----------------ELGGMDIGSIGKSSVSGSGKNK 274

  Fly   185 T-------------------------LRLDYAH------LAKVTRSLSHLFGL------------ 206
            .                         |..:..|      .|||...|::|..:            
  Fly   275 VAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALN 339

  Fly   207 ---SLLLLNVLCLGDWIIVCNVYFM--VAYLQVLPATLFLFGQVMFVV----------CPTLIKI 256
               |..:|:::..|..|....:||:  ....|.:| :||...:..|:.          |..||.:
  Fly   340 ELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIP-SLFRSAKNPFITVIVLSYTSGKCVYLIYL 403

  Fly   257 -WSICAAS-------HRC-VSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYH 312
             |....||       |:| |....:|..::             :...:|:::...:....||.:.
  Fly   404 SWKTSQASKRTGISLHKCGVVADDNLLYEI-------------VNHLSLKLLNHSVDFSACGFFT 455

  Fly   313 LNLQTLAGMFFFILEALVIFLQF 335
            |:::||.|:...|...|:|.:||
  Fly   456 LDMETLYGVSGGITSYLIILIQF 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 71/411 (17%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 71/411 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.