DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr57a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:414 Identity:81/414 - (19%)
Similarity:135/414 - (32%) Gaps:125/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FQLCGLVC------GWSG----------SRLGRLLSSTFLVLILIELVGEIETYFTEEN------ 55
            |.....:|      |.:|          |...|:.|.:..:.....|.|.:.....||:      
  Fly    14 FDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLA 78

  Fly    56 -PDN-----ESVPAYFAKVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKA-------T 107
             .||     .::....:.::.||.:....:.|          ||...:.:.|..:.|       .
  Fly    79 KADNLVLSISALELLMSTLVFGVTVISLQVFA----------RRHLGIYQRLAALDARLMSDFGA 133

  Fly   108 SFIYRH----------LILEIILFACNAFLVLSEYTIRGIYL-------------ENLRYAY--- 146
            :..||.          ::..|.|.|.|:..|......|.::|             ....|.:   
  Fly   134 NLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTL 198

  Fly   147 -SLQAVRARYLQMMVLVDRLDGKLEQLH----------------HRVISGSSDYKTLRL--DYAH 192
             .:..:|.|.||.::..:.|:.:..|||                |.:|...:....|.|  ..||
  Fly   199 AEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAH 263

  Fly   193 -LAKVTRSLSHLFGLSLLL------LNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVC 250
             ||..|..|..|||.|:.:      .|..|          |.|:.||.:             |:.
  Fly   264 DLAMSTSELYILFGQSVGIGQQNEEENGSC----------YRMLGYLAL-------------VMI 305

  Fly   251 PTLIKIWSICAASHRCVSKSK---HLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYH 312
            |.|.|:........|.:.:::   .|.::|.|...|....|..:|......:|..||. ..|:..
  Fly   306 PPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAKIQF-TSGLDV 369

  Fly   313 LNLQTLAGMFFFIL-EALVIFLQF 335
            :..:.:.|:|..|| ..|:|.:||
  Fly   370 VLSRKVIGLFTSILVNYLLILIQF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 79/412 (19%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 77/396 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.