DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr43a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:345 Identity:70/345 - (20%)
Similarity:121/345 - (35%) Gaps:87/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLEHFLTGYFQLCGLV---------CGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNE 59
            |...|.:.||.|.||.         .|....||.|:|||:||.                ||....
  Fly   178 WYIPFYSLYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLA----------------ENNATS 226

  Fly    60 SVPAYFAKVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEIILFACN 124
            ::.......:..|::....:.:  ||.|.........|..|....||.:   |.|||.:.|....
  Fly   227 AIKPQKVSTVKNVSVNRPAMPS--ALHASLTKLNGETLPSEAAGDKAAA---RSLILNVELLKLG 286

  Fly   125 AFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLD 189
            .|...:    :|:.|                                            |:|...
  Fly   287 YFPAKN----KGLLL--------------------------------------------KSLADS 303

  Fly   190 YAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPA--TLFLFGQVMFVVCPT 252
            :..|.|....||:.||:::|.:.|.||  ..:|...||:  :|::|..  ..:|:.|::: :|..
  Fly   304 HESLGKCVHLLSNSFGIAVLFILVSCL--LHLVATAYFL--FLELLSKRDNGYLWVQMLW-ICFH 363

  Fly   253 LIKIWSICAASHRCVSKSKHLQQQLKDLPGQT--PVERSQIEGFALQIMQDPIQIDVCGIYHLNL 315
            .:::..:....|....:|:...|.:.::..:.  |:....::.|..|::........||:..:|.
  Fly   364 FLRLLMVVEPCHLAARESRKTIQIVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNR 428

  Fly   316 QTLAGMFFFILEALVIFLQF 335
            ..|......|...|||.:||
  Fly   429 TILTSFASAIATYLVILIQF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 67/340 (20%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 70/345 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.