DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr23a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:388 Identity:84/388 - (21%)
Similarity:142/388 - (36%) Gaps:113/388 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLEHFLTGYFQL--------CGLVCGWSGSRLGRLLSSTFLVLI---LIELVGEIETYFTEENPD 57
            ||..|::.:.|.        |.|.|.     |..:|  ||...:   .|.:...::.:..:::..
  Fly    44 WLTWFISMWTQSVIYAQTIDCTLDCS-----LRHIL--TFFQTVSHAFIVVTSFLDGFRIKQDQL 101

  Fly    58 NESVPAYFAKVIMGVNMAYKMIHAWIALSAL-----------FECRR-----FR---YLLEELPP 103
            :|.:             |::....|:|.:.|           ..|..     ||   |.|:.|| 
  Fly   102 DEPI-------------AFEDSDPWLAFTVLAMLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLP- 152

  Fly   104 VKATSFIYRHLILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGK 168
                ||:  .|.::||.|......|            |:|       ||...||:::|...|..:
  Fly   153 ----SFL--ALQVQIISFILEVMKV------------NIR-------VRQTKLQLLILARELSCR 192

  Fly   169 ----------LEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVC 223
                      .:|..|||       |.|:..|..|..:...::..||.|||.:.::...  |.|.
  Fly   193 WPQRKQKPQFSDQQAHRV-------KDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFA--IFVS 248

  Fly   224 NVYFMVAYLQVLP----ATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDL---- 280
            |.|::...::..|    |.|...|.:..|..       .:.||...| .:|.:|.:|:..|    
  Fly   249 NSYWLFVDIRTRPWRIYAILLNLGFIFNVAL-------QMAAACWHC-QQSYNLGRQIGCLISKL 305

  Fly   281 --PGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFVSLVRT 341
              |..:.:....:..|:||.:.....:.....:.|||..|:.||..::..|||.:||:...|:
  Fly   306 VKPQGSKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 79/377 (21%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 63/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.