DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr21a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:414 Identity:74/414 - (17%)
Similarity:136/414 - (32%) Gaps:168/414 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TGYFQLCGLVCGWSGSRLGRLL-----SSTFLVLILIELVGEIETYFTEENPDNESVPAYFAKVI 69
            |||        .|...::...:     .:|.:||:|.|.|.:..|     :||.....|.:..:.
  Fly   101 TGY--------SWGSKQVMWAIFIYSCQTTIVVLVLRERVKKFVT-----SPDKRFDEAIYNVIF 152

  Fly    70 --------------------------MGVNMAYKM---------------------IHAWIALSA 87
                                      |..|..||.                     :.:|:...|
  Fly   153 ISLLFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLLSIA 217

  Fly    88 LFECRRFRYLLEELPPVKA-TSFIYRHLILEIILFA------CNAFLVLS-------EYTIRGIY 138
            :   ...:|.|:  |..:. .:|.|..:|..:..|.      ||||...|       :.||||  
  Fly   218 I---NLSQYFLQ--PDFRLWYTFAYYPIIAMLNCFCSLWYINCNAFGTASRALSDALQTTIRG-- 275

  Fly   139 LENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAH-LAKVTRSLSH 202
                                    ::...||           ::|:.|.:|.:| :.::.|:.|:
  Fly   276 ------------------------EKPAQKL-----------TEYRHLWVDLSHMMQQLGRAYSN 305

  Fly   203 LFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQV--------------MFVV---C 250
            ::|:                   |.:|.:...:.||   :|.:              :||:   |
  Fly   306 MYGM-------------------YCLVIFFTTIIAT---YGSISEIIDHGATYKEVGLFVIVFYC 348

  Fly   251 PTLIKIWSICAASHRCVSKSKHLQQQLK----DLPGQTPVERSQIEGFALQIMQDPIQIDVCGIY 311
            ..|:.|  ||..:| ..|:...|..|.|    :|.......:.::|...:.|.::|..:::.|..
  Fly   349 MGLLYI--ICNEAH-YASRKVGLDFQTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMNLDGYA 410

  Fly   312 HLNLQTLAGMFFFILEALVIFLQF 335
            ::|.:.:.....|:...||:.|||
  Fly   411 NINRELITTNISFMATYLVVLLQF 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 72/412 (17%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 74/414 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.