DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr8a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:376 Identity:79/376 - (21%)
Similarity:147/376 - (39%) Gaps:104/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RLLS-STFLVLILIELVGEIETYFTEE---------NPDNESVPAYFAKVIMGVNMAY------- 76
            ||:: |.||::.|..||  :...|:.|         ...|:::...||:  :||...|       
  Fly    38 RLMAWSLFLLISLSALV--LACLFSGEEFLYRGDMFGCANDALKYVFAE--LGVLAIYLETLSSQ 98

  Fly    77 -KMIHAW-------------IALSALFE--CRRFRYLLEELPPVKATSFIYRHLILEIILF---- 121
             .:.:.|             ::|.:.|:  |   |||:          |:|..:..|:.:.    
  Fly    99 RHLANFWWLHFKLGGQKTGLVSLRSEFQQFC---RYLI----------FLYAMMAAEVAIHLGLW 150

  Fly   122 ---ACNAFLVLSEYTIRGI----YLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHH----- 174
               |....::|...|...:    ||.||::...|:.:|    :.:..::|..|.|.:...     
  Fly   151 QFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLR----EQLTGLEREMGLLAEYSRFASET 211

  Fly   175 -RVISGSSDYKTLRL-----DYAHLAKVTRSLSHLFGLS----LLLLNVLCLGDWIIVCNVYFMV 229
             |...|...:...||     .|:|:..:.:.....|..|    ||.:|:.      |..:.||| 
  Fly   212 GRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIR------IAVDCYFM- 269

  Fly   230 AYLQVLPATLFLFGQVM----FVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQT-----P 285
             |..:       :..|:    :::.|.|::|.:...||..|:.....:..||.::...:     |
  Fly   270 -YYSI-------YNNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSCP 326

  Fly   286 VERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFV 336
            ....||:.|:||::..||:||..|:..|:...|..|...:...::..:||:
  Fly   327 DLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQFI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 77/373 (21%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 77/373 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.