DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and lite-1

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:403 Identity:78/403 - (19%)
Similarity:135/403 - (33%) Gaps:150/403 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DNESVPAYFAKVIMGVNMAYK-------MIHAWIALSALF--ECRRFRYL-------LEELPPVK 105
            |....|.|:..:|:|:|.:.:       .|::|:....|.  ..|:|..:       .|.|....
 Worm    45 DRTLYPIYYLLLILGLNQSIRPNNSLLFRIYSWLVFCLLLFTTLRKFNQVGVRPNGTRENLQEFF 109

  Fly   106 ATSFIYRHLILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLE 170
            |..   |.:|.     .|||.::||     |: |.:|: .|:|.|.|.:.|:::.... |:.:.:
 Worm   110 ANP---RSMIT-----LCNALIMLS-----GL-LASLQ-LYTLGAKRLKPLKILCQFS-LNVRTK 158

  Fly   171 QLHHR---------VISG-------------------------SSDYKTL---RLD--------- 189
            |...|         |.||                         :.|.:|:   .||         
 Worm   159 QAERRQFMINTFLAVFSGLLALTMAATYAMSKWGYILYIVGTPNLDTETIFCVLLDSYALFVSRA 223

  Fly   190 ---------YAHLAKVTRSLSHLFG--------------LSLLLLNVLCL-------GDWIIVCN 224
                     |.|.:.:.||:.||..              .||..::...:       |..:|...
 Worm   224 AISALAILFYQHCSVIRRSIKHLINEMVPAEQDECPLPESSLQKIHDCQISYQRIFNGKAVIEEY 288

  Fly   225 VYFMVAYLQVLPATLFLFGQVMFV------VC---PTLIKIW----------------------- 257
            ..|::.|...:...:|.|  :|||      :|   ...|.||                       
 Worm   289 YSFVLFYSYGVCIPIFCF--LMFVGMSAQSICWSEVVSIVIWIVNAILVLLLFSLPAFMINEDGD 351

  Fly   258 SICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMF 322
            .:.|:|.|...::.|.::.|..|        ||:..|..||....:.:..|..::::...|..:|
 Worm   352 RLVASSFRMYHETFHEERDLTVL--------SQMTFFTFQIHSTKLTLSACNYFYMDRSILLSLF 408

  Fly   323 FFILEALVIFLQF 335
            ..||...:|..:|
 Worm   409 SAILTYFLILWEF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 77/401 (19%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 71/373 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.