DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr22d

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster


Alignment Length:321 Identity:60/321 - (18%)
Similarity:117/321 - (36%) Gaps:56/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESVPAYFAKVIM-GVNMAYKMIHAWIAL 85
            |....|..:.:.    |:|:|     ..||.....:   .||:...||. ||.:...::..|:. 
  Fly   109 WRSKHLEEIYNG----LMLLE-----AKYFCSNAVE---CPAFDGYVIQKGVVIVVGLLAPWMV- 160

  Fly    86 SALFECRRFRYLLEELPPVKATSFIYRHLILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQA 150
                   .|.....:||.:.         :|.:.:......|:...|.:..:.:  .|:.:.:..
  Fly   161 -------HFGMPDSKLPVLN---------VLVVSMVKLGTLLLALHYHLGVVII--YRFVWLINR 207

  Fly   151 VRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLC 215
                  :::.||..|.|     :|:  ..||..:.|...|..|..:...|:..:....:|:..:.
  Fly   208 ------ELLSLVCSLRG-----NHK--GSSSRVRFLLKLYNKLVNLYSKLADCYDCQTVLMMAIF 259

  Fly   216 LGDWIIVCNVYFMVAYLQVLPATLFLFGQVMF--VVCPTLIKIW---SICAASHRCVSKSKHLQQ 275
            |...||||  ::|:.|...|....|....:||  .:....:..|   .:|....:...::..:.:
  Fly   260 LAANIIVC--FYMIVYRISLSKMSFFVMLIMFPLAIANNFMDFWLSMKVCDLLQKTGRQTSMILK 322

  Fly   276 QLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFV 336
            ...|:..........|..|||.......:...||::|:|.:    |.|.:..|.|::|.::
  Fly   323 LFNDIENMDKDLEISISDFALYCSHRRFKFLHCGLFHVNRE----MGFKMFVASVLYLLYL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 60/318 (19%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 60/321 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.