DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr22c

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:396 Identity:89/396 - (22%)
Similarity:146/396 - (36%) Gaps:138/396 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRLGRLLSSTFLV--------LILIELV---GEIETYFTEENPDNESVPAYFAKVIMGVNMAYKM 78
            ||.|:|..|.||:        .:|:::|   |:           ...:|..||:     |...:.
  Fly    36 SRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQ-----------KLGIPEAFAR-----NSVLEN 84

  Fly    79 IHAWIALSALFEC-----------RRFRYLLEELPPVKATSFIYRHLILEIILFA------C--- 123
            .|....:.|:|.|           .|.:.|..||            |:||...||      |   
  Fly    85 THYTTGMLAVFSCVVIHFLNFWGSTRVQDLANEL------------LVLEYQQFASLNETKCPKF 137

  Fly   124 NAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRL----------------------- 165
            |:|::....::.|:.|..|..||.|..  ..:...|||::.|                       
  Fly   138 NSFVIQKWLSVIGLLLSYLSIAYGLPG--NNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRYL 200

  Fly   166 ---DGK-LEQLHHRVISGSSDYKTLRLDYAHLAKVTRSL--------SHLFGLSLLLL-----NV 213
               :|: ||.:.:..:..|.|...:|   .:|:...|.|        ::.:.::|:|.     |.
  Fly   201 WLINGQLLEMVTNLKLDCSVDSSRIR---KYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNF 262

  Fly   214 LCLGDWIIV---CNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSI---CAASHRCVSKSKH 272
            |.:..||::   .|:.|:  ||.:.|  |||           |:.:|::   .|||....:..|.
  Fly   263 LAIYSWIVLDISMNINFI--YLLIFP--LFL-----------LVNVWNLWLSIAASDLAENAGKS 312

  Fly   273 LQQQLK---DLP-GQTPVERSQIEGFALQIMQDPIQIDVCGIYHLN----LQTLAGMFFFILEAL 329
            .|..||   ||. ....:||| :..|||..........|||::.:|    .|.:...|.:    |
  Fly   313 TQTVLKLFADLEVKDIELERS-VNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLY----L 372

  Fly   330 VIFLQF 335
            :..:||
  Fly   373 IYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 87/394 (22%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 89/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.