DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr28b

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:367 Identity:81/367 - (22%)
Similarity:151/367 - (41%) Gaps:73/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTGYFQLCGLVCGWSG------------SRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESV 61
            :|.:..|..:|.|:.|            .||.|.|.....:.:.::.||               |
  Fly   114 ITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVG---------------V 163

  Fly    62 PAYFAKVIMGVNMAYKMIHAWIALSALFECRRFRYLL-EELPPVKAT--SFIYRHLI--LEIILF 121
            ...::||:   ..:|.::.:...::.||....|..|. .|:.|..|.  :|:.:|.:  :.|.||
  Fly   164 KIMYSKVL---RFSYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIALF 225

  Fly   122 ACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTL 186
            :|..:||.....:....|:||.:.:..::::|           ::.|...|  :.:...|.|..:
  Fly   226 SCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKA-----------VNQKQRSL--QCLDSFSMYTIV 277

  Fly   187 RLDYAHLAKVTRSLSHLF---------GLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLF 242
            ..|.|.:.:.:..:.||.         ..:..||.::.:...|||.:.|:::..|.........|
  Fly   278 TKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGKSKRESKF 342

  Fly   243 GQVMFVV---CPT---LIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVE--RSQIEGFALQIM 299
            ..|.||.   |..   ||.|.||...|:|.:.||:.....:..|..:|...  :.:::.|::|:|
  Fly   343 KTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLM 407

  Fly   300 QDPIQIDVCGIYHLNLQTLAGMFFFILEA----LVIFLQFVS 337
            ...|.....|::::: :||   :|.|..|    |:|.|||.|
  Fly   408 HLKINFTAAGLFNID-RTL---YFTISGALTTYLIILLQFTS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 78/363 (21%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 78/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.