DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr22b

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:374 Identity:77/374 - (20%)
Similarity:137/374 - (36%) Gaps:89/374 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGSRLGRLLSST-----------FLVLILIELVGEIETYFTE---ENPDNESVPAYFAKVIMG-V 72
            ||.|:.:|..|.           ||:..||.|..|...:..|   .||..|.:     .|::| :
  Fly    36 SGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAFEYRKHKLEAFKRNPVLEMI-----NVVIGII 95

  Fly    73 NMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEIILFA------C---NAFLV 128
            |:...:|   :.....:..|:...:..||            ||||...|.      |   |.|::
  Fly    96 NVLSALI---VHFMNFWGSRKVGEICNEL------------LILEYQDFEGLNGRNCPNFNCFVI 145

  Fly   129 LSEYTIRGIYLE--NLRYA------------------YSLQAVRARYLQMMVLVDR----LDGKL 169
            ....||.|..|.  .|.:|                  :||......|...::|:.|    ::.:|
  Fly   146 QKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCLMEFSLNLNIMHYHVGVLLIYRYVWLINEQL 210

  Fly   170 EQLHHRV-ISGSSDYKTLRLD---YAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVA 230
            :.|..:: ::..:|:..:...   |..|.::.|.|...:...:.|..:..|...|:|  :||::.
  Fly   211 KDLVSQLKLNPETDFSRIHQFLSLYKRLLELNRKLVIAYEYQMTLFIIAQLSGNIVV--IYFLIV 273

  Fly   231 Y-LQVLPATLFLFGQVMFVVCPT--LIKIW------SICAASHRCVSKSKHLQQQLKDLPGQTPV 286
            | |.:...::||      |..|.  ||.||      :.|..:.:...::..:.:...||..:...
  Fly   274 YGLSMRTYSIFL------VAFPNSLLINIWDFWLCIAACDLTEKAGDETAIILKIFSDLEHRDDK 332

  Fly   287 ERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335
            ....:..||........:..:||::.:|.:....|.......||..:||
  Fly   333 LEMSVNEFAWLCSHRKFRFQLCGLFSMNCRMGFKMIITTFLYLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 75/372 (20%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 77/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.