DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr36a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:408 Identity:82/408 - (20%)
Similarity:154/408 - (37%) Gaps:120/408 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YFQLCGLV---CGWSGSRL-----GRLLSSTFLVLILIELVGEI------ETYFTEENPDNESVP 62
            |.|:.||:   ..|...|:     |.|.:....|||.:.|:.:|      :.||...|    .:.
  Fly    15 YGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDVYFGRAN----QLH 75

  Fly    63 AYFAKVIMGVNMA---YKMIHAW---IALSALFECRRFRYLLEELPPVK---------------A 106
            .|...|::.:.||   ..:::.|   ..|..|.|| ..|..|:: |.||               .
  Fly    76 QYVIIVMVSLRMASGISAILNRWRQRAQLMRLVEC-VLRLFLKK-PHVKQMSRWAILVKFSVGVV 138

  Fly   107 TSFIYRHLILEII-LFACNAFL-VLSEYTIRGI--------YLENL--RYAYSL------QAV-- 151
            ::|:...:.:|.: ....|.|: :.|::.:..|        ||..|  |..|.|      ||:  
  Fly   139 SNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYYHLLKTEVRQAIHE 203

  Fly   152 ----------RARYL-QMMVLVDRLD--GKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHL 203
                      ||.:: :...|.||:|  .||:.                    .|..:...|:.:
  Fly   204 SQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQN--------------------QLQSIVTQLNQV 248

  Fly   204 FGLSLLLLNVLCLGDWII--VCNVYFMVA---------YLQVLPATLFLFGQVMFVVCPTLIKIW 257
            ||:.    .::..|.:.|  |...|...:         :|.|..|.| :|...:|.....::.::
  Fly   249 FGIQ----GIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAAL-VFSWFLFYYTSAILNLF 308

  Fly   258 SICAASHRCVSKSKHLQQQLKDLPGQTP-----VERSQIEGFALQIMQDPIQIDVCGIYHLNLQT 317
            .:.    :.....|.:::.|::....|.     :|:| .|...||::::|::|:|..|:.:...:
  Fly   309 VML----KLFDDHKEMERILEERTLFTSALDVRLEQS-FESIQLQLIRNPLKIEVLDIFTITRSS 368

  Fly   318 LAGMFFFILEALVIFLQF 335
            .|.|...|:...:..:|:
  Fly   369 SAAMIGSIITNSIFLIQY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 81/406 (20%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 82/408 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.