DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr36b

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:399 Identity:76/399 - (19%)
Similarity:150/399 - (37%) Gaps:83/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLEHFLTGYFQLCGLVCGWSG----SRLGRLLSS------TFL--VLILIELV------GEIETY 50
            |:...|......|.|: |.|.    .|.||:..|      .|:  :.|||.::      |:....
  Fly     4 WVVLLLKAVHIYCYLI-GLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLL 67

  Fly    51 FTEENPDNESVPAYFA--KVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFIYRH 113
            |...|..:|.|....:  |::.|:   ..:::.|:....:.:..:....|..:.|...:...:..
  Fly    68 FQSANKLHEYVIIIMSGLKIVAGL---ITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGI 129

  Fly   114 LILEIILFACNAFLVLSEYTI-------------RGI-------YLENL---RYAYSLQAVRARY 155
            |:...|.||    :.|.:.|:             .|:       ::.||   ::...:..:||:|
  Fly   130 LLKAFISFA----IELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQY 190

  Fly   156 LQM-----MVLVDRLDGKLEQLHHRVISGSSDYKTLRLD-----YAHLAKVTRSLSHLFGLSLLL 210
            ..|     ||:.:.......||.:........|.:.:|:     .:.|..:...|..:||:.   
  Fly   191 RIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQ--- 252

  Fly   211 LNVLCLGDWI--IVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHL 273
             .::...::.  ||...|...:..:..|..|.|..:...:|| .||.::.:.|..: |.:..:.|
  Fly   253 -GLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVC-ILITLFYLDALVN-CNNMLRVL 314

  Fly   274 QQQLKDLPGQTPVERS------------QIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFIL 326
            ... ||..|... ||:            ..|...||:.::|::|:|.|::.:...:.|.|...::
  Fly   315 DHH-KDFLGLLE-ERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVI 377

  Fly   327 EALVIFLQF 335
            ...:..:||
  Fly   378 VNSIFLIQF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 73/394 (19%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 75/394 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.