DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr36c

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:421 Identity:70/421 - (16%)
Similarity:136/421 - (32%) Gaps:128/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LEHFLTGYFQLCGLVCG-------WSGSRL---------GRLLSSTFLVLILIELVGE---IETY 50
            ||.||.|.....||..|       |:..|:         ...|.|....|.:....|.   :...
  Fly     3 LESFLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWTGNTNIVNAI 67

  Fly    51 FTEENPDNESVPAYFA--KVIMG--------------VNMAYKMIHAWIALSALFECRRFRYLLE 99
            |...|..:|.|.|...  :::.|              :::|.|::..::|...:....|:..|  
  Fly    68 FGRANMLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVRRMSRWGIL-- 130

  Fly   100 ELPPVKATSFIYRH----LILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMM- 159
                   |.||:..    |.:.::|.|..:  |.|::.: |:.|:...:.....|:..:::.|: 
  Fly   131 -------TKFIFGSITDGLQMAMVLSAMGS--VDSQFYL-GLGLQYWMFVILNMAMMQQHMIMLF 185

  Fly   160 --------------VLVDRLDGKLEQLHHRVI-----SGSSDYKTLRLDYAHLAKVTRSLSHLFG 205
                          |:.:..|..|...|..|.     |.:...:.:....:.|..:...:..:||
  Fly   186 VRTQFQLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQMEEVFG 250

  Fly   206 -------------------------------LSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATL 239
                                           ||:.|..|:....|   |..|::...|.:     
  Fly   251 IQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSW---CFFYYLDGMLNL----- 307

  Fly   240 FLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQ 304
                .||..|.....::..|.......|.....|::..::|              .||::::|::
  Fly   308 ----SVMLHVQDDYWEMLQILGKRTIFVGLDVRLEEAFENL--------------NLQLIRNPLK 354

  Fly   305 IDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335
            |.|..:|.:.......||..::...:..:|:
  Fly   355 ITVVKLYDVTRSNTMAMFGNLITHSIFLIQY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 67/417 (16%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 66/416 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.