DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr59a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:365 Identity:68/365 - (18%)
Similarity:132/365 - (36%) Gaps:79/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRLGR----LLSSTFLVLILIELVGEIETYFTEE-NPDNESVPAYFAKVIMGVNMAYKMIHAWIA 84
            ||:.|    |:::.||.|:........:...|.: .|....|..|....|....:||.:|.....
  Fly    30 SRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISRCYR 94

  Fly    85 LSALFECRR---------------FRYLLEELPPVKATSFIYRHL--ILEIILF---------AC 123
            .:.|.:.:|               ...||..:..:|..:..|..|  ||.:.::         .|
  Fly    95 DAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILAVFIYQWKAQNWSNLC 159

  Fly   124 NAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDY----K 184
            |..||....||  :::....|..||..:...|          |...:||:..|...|.|.    |
  Fly   160 NGLLVNISLTI--LFVNTFFYFTSLWHIARGY----------DFVNQQLNEIVACQSMDLERKSK 212

  Fly   185 TLRLDYA---HLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLF------ 240
            .||..:|   :|:...|.::..:|..:|.:..           .||:.:.:.....|::      
  Fly   213 ELRGLWALHRNLSYTARRINKHYGPQMLAMRF-----------DYFIFSIINACIGTIYSTTDQE 266

  Fly   241 -----LFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQ 300
                 :||.:::     .::.:......:.|...|:: |.|.|....::.:. :::..:.:....
  Fly   267 PSLEKIFGSLIY-----WVRSFDFFLNDYICDLVSEY-QMQPKFFAPESSMS-NELSSYLIYESS 324

  Fly   301 DPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFVSLVR 340
            ..:.:.|||:|.:|.:....|...|:....:..||..::|
  Fly   325 TRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQFHLVMR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 65/358 (18%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 67/362 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.