DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr92a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:340 Identity:60/340 - (17%)
Similarity:125/340 - (36%) Gaps:103/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLGRLLSSTF------------LVLILIELVGEIETYFTEENPDNESVPAYFAKVIMGVNMAYKM 78
            ||.|.:|..|            |:|||:.|                            ::.|::.
  Fly   119 RLFRQVSDLFKTKTPGFGGRRELILILLNL----------------------------ISFAHEQ 155

  Fly    79 IHAWIALSALFECRRFRYLLE---ELPPVKATS-FIY----RHLILEIILFACNAFLVLSEYTIR 135
            .:.|..:...|.   :|:|::   :...|.||: ||:    .:|.|.::....|.::    ||..
  Fly   156 TYLWFTIRKGFS---WRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLYSELNKYV----YTNL 213

  Fly   136 GIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQ---LHHRVISGSSDYKTLRLDYAHLAKVT 197
            .|.|:.|..:.|.|.:|           |:..:||:   |:..:...|..:..|.:....||   
  Fly   214 RIQLQKLNTSGSKQKIR-----------RVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLA--- 264

  Fly   198 RSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLF--LFGQVMFVVCPTLIKIWSIC 260
                       |:..||      ::..:.|.||....|.:.:|  |.|:       .::.::.:.
  Fly   265 -----------LIYKVL------LIALIGFNVAVEFYLNSFIFWILLGK-------HVLDLFLVT 305

  Fly   261 AASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFI 325
            .:....|::..::..|..:: |.....::.::...|.:.....::.:.|::.:...    .:...
  Fly   306 VSVEGAVNQFLNIGMQFGNV-GDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQM----QYLQF 365

  Fly   326 LEALVIFLQFVSLVR 340
            |.||:..|.|::..|
  Fly   366 LSALLSGLAFIAQYR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 58/333 (17%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 60/340 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.