DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr93d

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster


Alignment Length:413 Identity:74/413 - (17%)
Similarity:147/413 - (35%) Gaps:127/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLWLEHFLTGYFQLCGLVCG---------------WSGSRLGRLLSSTFLVLILIELVGEIETYF 51
            |:.:..|::.|.:...|||.               ||.....:.:|.|..::.|.     |..:.
  Fly     7 SVGILRFMSFYARFLSLVCFRLRKQKDNNVWLEEIWSNRSRWKWISVTLRIVPLC-----IYAFT 66

  Fly    52 TEENPDNE---------------SVPAYFA----KVIMGVNMAYKMIHAWIALSAL--FECRR-- 93
            ..|...|.               |:|.|.:    |:..|..:. |:::.::.:..|  .:.||  
  Fly    67 YAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVT-KLVNQYLHIFRLGTLDIRRRS 130

  Fly    94 --------FRYLLEELPPVKATSFI---------YRHLILEI----ILFACNAFLVLS---EYTI 134
                    |..:|.....:....||         ::|:|..:    :...||:.:...   ..::
  Fly   131 QFGGGRELFLLILSVCCQIHEYVFILVIASRLCGFQHIIWWVSYTYVFIICNSIMCFGFIWHLSL 195

  Fly   135 RGIYLE---NLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKV 196
            ..:|.|   |||:....|....|               :|...||      .|::.| :..::.|
  Fly   196 GVLYAELNDNLRFESGFQTAFLR---------------KQQRIRV------QKSMAL-FKEISSV 238

  Fly   197 TRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICA 261
            ..||..:|.:.|.|..:|.|...::|.  |.|:..|......::.|.....:  .||:.:.:|..
  Fly   239 VTSLQDIFNVHLFLSALLTLLQVLVVW--YKMIIDLGFSDFRIWSFSLKNLI--QTLLPVLAIQE 299

  Fly   262 ASHR------------CVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLN 314
            |:::            .|.||||..:              .:|.|...:.....::::.|:::::
  Fly   300 AANQFKQTRERALDIFLVGKSKHWMK--------------SVEIFVTHLNLSEFRVNLLGLFNVS 350

  Fly   315 LQTLAGMFFFILEALVIFLQFVS 337
            .:    :|..|:.|:..:|.||:
  Fly   351 NE----LFLIIVSAMFCYLVFVT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 71/404 (18%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 73/409 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.