DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr39b

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:397 Identity:83/397 - (20%)
Similarity:145/397 - (36%) Gaps:90/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LWLEHFLTGYFQLCGLVCGWSGSRLGRLLSSTFL------VLILIELVG-EIETYFTEENPDNE- 59
            |:..|....||.|.||| .||.|    ...|.|:      :||::..|. .|..||    |.:. 
  Fly     2 LYSFHPYLKYFALLGLV-PWSES----CAQSKFVQKVYSAILIILNAVHFGISIYF----PQSAE 57

  Fly    60 -------SVPAYFAKVI-MGVNMAYKMIHAWIALSALFE-CRRFRY------------------- 96
                   :|..:.|::: :.|.:...|:|    ....|. ||..:|                   
  Fly    58 LFLSLMVNVIVFVARIVCVTVIILQVMVH----YDDYFRFCREMKYLGLRLQCELKIHVGRLKWQ 118

  Fly    97 ------------LLEELPPVKAT---SFIY-RHLILEIILFACNAFLVLSEYTIRGIYLENLRYA 145
                        |:..||.:...   |.:| ...:|.|::......|||       :.:|.|.:.
  Fly   119 SYAKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVL-------LNVELLGHH 176

  Fly   146 YSLQAVRARYL---QMMVLVDRLDGKLEQLHHRVISGSSDY-KTLRLDYAHLAKVTRSLSHLFGL 206
            .||..:|.:.:   .:|.....|||...:|      .|.:: ..|:..:..|..:....:.|||.
  Fly   177 VSLLGIRLQNVLECHLMGANCTLDGNANRL------CSLEFLLALKQSHMQLHYLFTHFNDLFGW 235

  Fly   207 SLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSK 271
            |:|...|:...|..:  |:|:....|..:....:|:. ...|..|:...|...|.....|..:|.
  Fly   236 SILGTYVVLFSDSTV--NIYWTQQVLVEVYEYKYLYA-TFSVFVPSFFNILVFCRCGEFCQRQSV 297

  Fly   272 HLQQQLKDLP-----GQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVI 331
            .:...|::|.     |:....:..:..|.||:.|:.:.|:..|....:...|..:....:..|::
  Fly   298 LIGSYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIV 362

  Fly   332 FLQFVSL 338
            .:||.|:
  Fly   363 LMQFSSV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 79/388 (20%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 80/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.