DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr39a

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:399 Identity:88/399 - (22%)
Similarity:158/399 - (39%) Gaps:110/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTGYFQLC---GLVC-GWSGSRLG-RLLSSTFLVLI-------LIELVGEIETY----FTEENPD 57
            |..|::||   |:.| .::.::.. ||..|....::       |:..:..:.||    |..|...
  Fly     8 LCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTT 72

  Fly    58 NESVPAYFAKVIMGVNMAYKMI-HAWIALSALFECRRFR----YLLEELPPVK------------ 105
            ..:   :|.:::|.:.:...:: :||:........|..|    |....|..|:            
  Fly    73 TGN---HFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLANVRLLLPKRLLWLII 134

  Fly   106 ATSFIY-----RHLILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDR- 164
            ||:.:|     :..|.|.:..|...|::    |..|..|..|..::::    ..|..|:.:|.. 
  Fly   135 ATNVVYMANFIKTCIFEWLTDASRLFVI----TSLGFPLRYLVTSFTM----GTYFCMVHIVRLV 191

  Fly   165 LDGKLEQLHHRVISGSSDYK-----TLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCL---GDWII 221
            ||....|: :.:|..|:|.|     .|||.                        :||   ...::
  Fly   192 LDWNQSQI-NAIIDESADLKMTSPNRLRLR------------------------VCLEMHDRLML 231

  Fly   222 VCN-----VYFMVAYLQVLPATLFLFGQV-MFVVCPT----LIK-----IW-----SICAA---S 263
            :||     ||..:|:|..:.|:|.:.|.: :.:|..|    ::|     :|     ..|||   |
  Fly   232 LCNDEISLVYGFIAWLSWMFASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMS 296

  Fly   264 HRCVSKSKHLQQQLKDLPGQ-TPVERSQIEGFALQ-IMQDPIQIDVCGIYHLNLQTLAGMFFFIL 326
            :|...::....:.|..:|.. |.::| .||.|.|: :.|.|| :...|.:.|:..||..:|..|.
  Fly   297 NRVTIQANKTAKMLTKVPRTGTGLDR-MIEKFLLKNLRQKPI-LTAYGFFALDKSTLFKLFTAIF 359

  Fly   327 EALVIFLQF 335
            ..:||.:||
  Fly   360 TYMVILVQF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 86/397 (22%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 88/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.