DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr9a and Gr98b

DIOPT Version :9

Sequence 1:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:380 Identity:66/380 - (17%)
Similarity:115/380 - (30%) Gaps:164/380 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RRFRYLLEELPPVKATSFIYRHLILEIILFACNAFLVLS------EYTIRGI--YLENLRYA-YS 147
            ||.|:.|       .|.:::....:...:|..:.|.:::      ||.:...  .:.|::.: ||
  Fly    37 RRLRWYL-------MTGYVFYATAILATVFIVSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYS 94

  Fly   148 LQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFG-----LS 207
            :.|: |.:|.|::...||.|              .||    |.|.|.......|..||     .|
  Fly    95 IMAI-ANHLNMLINYRRLGG--------------IYK----DIADLEMDMDEASQCFGGQRQRFS 140

  Fly   208 LLLLNVLCLGDWIIV---------------------------------------CNVYFMVAY-- 231
            ......||:|.|:|:                                       | |:.::.|  
  Fly   141 FRFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYC-VFVLIIYEL 204

  Fly   232 -----------------------LQVL--------------------------PATLFLF---GQ 244
                                   ||.|                          |..|.||   |.
  Fly   205 VLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGL 269

  Fly   245 VM----------------------FVVCPT-LIKIWSICAASHRCVSKSKHLQQQLKDL------ 280
            .:                      |:||.| |:.:...|..|.||::......:.|..:      
  Fly   270 TILHMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSAD 334

  Fly   281 PGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335
            |....:.|. :..::||:....::....|::.:||:...|:...|...::|.:||
  Fly   335 PNFAMLTRG-LREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 64/378 (17%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 66/380 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.