DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Pi15

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:256 Identity:75/256 - (29%)
Similarity:99/256 - (38%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQNYCDPELC----------PSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAG 77
            |.|:.|.|..          |..|.      .|::|       |.|  :..||..||:.|..:  
Mouse    45 ANNFTDTEAALSTPLESADIPKARR------KRYIS-------QND--MIAILDYHNQVRGKV-- 92

  Fly    78 GGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVF 142
                 ||.|..|..|.||..||:.|...|..|...|..   :...|:.|||||:...|...:.  
Mouse    93 -----FPPAANMEYMVWDENLAKSAEAWAATCIWDHGP---SYLLRFLGQNLSVRTGRYRSIL-- 147

  Fly   143 LRQRIAAWFDENRDATSGDMEDYQMR-----GGPAIGHFTTMVNERNNRVGCAIARFTDAN---N 199
              |.:..|:||.:|......:|...|     .||...|:|.||...:||:||||....:.|   :
Mouse   148 --QLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGS 210

  Fly   200 V--QATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNY-----PNLCSPNEVYNYNQW 252
            |  :|..|.||||.. |.:....|:.|...|.|.    .:|     .|||.|....||..|
Mouse   211 VWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCP----PSYGGACTDNLCFPGVTTNYLYW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 50/156 (32%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 50/156 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.