DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and PRY2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:40/152 - (26%)
Similarity:61/152 - (40%) Gaps:37/152 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSIL 132
            ||.:|.|....|           :::|..|||..|...|.....:.:...:...|   |:||::.
Yeast   200 HNTKRALHKDTG-----------SLTWSDTLATYAQNYADSYDCSGNLVHSGGPY---GENLALG 250

  Fly   133 F--TRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG-GPAIGHFTTMVNERNNRVGCAIARF 194
            :  |.|||          ||::|   .||   .||...| ..:.||||.:|.:..:.|||.:   
Yeast   251 YGTTGSVD----------AWYNE---ITS---YDYSNPGFSESAGHFTQVVWKGTSEVGCGL--- 296

  Fly   195 TDANNVQATLLACNY-AVTNVV 215
            ..........:.|:| |..||:
Yeast   297 KSCGGEWGDYIICSYKAAGNVI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/145 (26%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 40/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.