DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and PRY3

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:42/171 - (24%)
Similarity:62/171 - (36%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYA--G 126
            :|..||:.|.|           .|..|.::|..|||..|...|.|.     :|....|:...  |
Yeast    29 VLNEHNKFRAL-----------HVDTAPLTWSDTLATYAQNYADQY-----DCSGVLTHSDGPYG 77

  Fly   127 QNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG---GPAIGHFTTMVNERNNRVG 188
            :||::.:|   |...     :.||:        |::..|....   ..:.||||.:|.:....:|
Yeast    78 ENLALGYT---DTGA-----VDAWY--------GEISKYNYSNPGFSESTGHFTQVVWKSTAEIG 126

  Fly   189 CAIARF-TDANNVQATLLACNYAVTNVVNNPVYRAGTAASE 228
            |..... |..||    .:.|:|      |.|....|..|.|
Yeast   127 CGYKYCGTTWNN----YIVCSY------NPPGNYLGEFAEE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/151 (24%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 39/164 (24%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.