DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT1G50050

DIOPT Version :10

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:160 Identity:36/160 - (22%)
Similarity:55/160 - (34%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 YFTTGFRRAVYNM--DVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHD 274
            :..|.:.:|||.:  .:|:        |.::.||...:.:|..:             ...|...|
plant   260 WLDTPYNQAVYGIVDKLGS--------LVVRMVFLPFEESSYTI-------------FARFASGD 303

  Fly   275 VQEFCRVLLDNLETKMK------------GTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFY 327
            .||..:.|...|...:|            |.|...|:..|..|...|       |.|:|....||
plant   304 YQERNKKLGIYLTVALKLVILIGLIFMAFGPSYSYSLIRLLYGEKWS-------DGEASLALQFY 361

  Fly   328 DVQLNVLGMDSLERAF-EAYTTSEILDDEN 356
            .:.:.||.|:....|| .|..|...|:..|
plant   362 CLYIIVLAMNGTSEAFLHAVGTKNELERSN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 CAP_euk 63..210 CDD:349399
AT1G50050NP_175427.1 CAP_PR-1 27..151 CDD:349400
RlmN <156..183 CDD:440582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.