DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:205 Identity:60/205 - (29%)
Similarity:82/205 - (40%) Gaps:44/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            ||.|||:.|..:.       |.|..|..|:||..|.:.||..|.||...|..   |:.....|||
Human    59 ILMLHNKLRGQVQ-------PQASNMEYMTWDDELEKSAAAWASQCIWEHGP---TSLLVSIGQN 113

  Fly   129 LSILFTRSVDVAVFLRQR-----IAAWFDENRDAT---SGDMEDY--QMRGGPAIGHFTTMVNER 183
            |.         |.:.|.|     :.:|:||.:|.|   ..:...:  :...||...|:|.:|...
Human   114 LG---------AHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWAT 169

  Fly   184 NNRVGCAI---ARFTDANNV--QATLLACNYAVT-NVVNNPVYRAGTAASECTTG-----RNSNY 237
            .|::|||:   .:.|....|  .|....|||:.. |.:....|:.|...|||...     ||   
Human   170 TNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRN--- 231

  Fly   238 PNLCSPNEVY 247
             |||...|.|
Human   232 -NLCYREETY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 46/160 (29%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 46/160 (29%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.