Sequence 1: | NP_727412.2 | Gene: | CG32679 / 318150 | FlyBaseID: | FBgn0052679 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113664.1 | Gene: | CRISPLD2 / 83716 | HGNCID: | 25248 | Length: | 497 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 60/205 - (29%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 44/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
Fly 129 LSILFTRSVDVAVFLRQR-----IAAWFDENRDAT---SGDMEDY--QMRGGPAIGHFTTMVNER 183
Fly 184 NNRVGCAI---ARFTDANNV--QATLLACNYAVT-NVVNNPVYRAGTAASECTTG-----RNSNY 237
Fly 238 PNLCSPNEVY 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32679 | NP_727412.2 | SCP_euk | 63..210 | CDD:240180 | 46/160 (29%) |
CRISPLD2 | NP_113664.1 | SCP_euk | 56..201 | CDD:240180 | 46/160 (29%) |
LCCL | 286..370 | CDD:128866 | |||
LCCL | 387..479 | CDD:128866 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151210 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2242 |
SonicParanoid | 1 | 1.000 | - | - | X35 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.880 |