DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Crispld1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:207 Identity:57/207 - (27%)
Similarity:84/207 - (40%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC 116
            |:....|..:..||.|||:.|:.:       :|:|..|..|:||..|.:.|...|..|...|.. 
Mouse    53 GKRAITDNDMQSILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCLWEHGP- 109

  Fly   117 RNTNTYRYAGQNLSILFTRSVDVAVFLRQR-----IAAWFDENRDAT---SGDMEDY-QMR-GGP 171
              .:.....||||.         |.:.|.|     :.||:||.||.:   ..:.:.| ..| .||
Mouse   110 --ASLLPSIGQNLG---------AHWGRYRPPTFHVQAWYDEVRDFSYPYENECDPYCPFRCSGP 163

  Fly   172 AIGHFTTMVNERNNRVGCAIARFTDANN-----VQATLLACNYAVT-NVVNNPVYRAGTAASECT 230
            ...|:|.:|...::|:|||:....:.|.     .:|..|.|||:.. |...:..|:.|...|.|.
Mouse   164 VCTHYTQVVWATSSRIGCAVNLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACP 228

  Fly   231 TGRNSN-YPNLC 241
            ...... ..|||
Mouse   229 PSFGGGCRENLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 46/161 (29%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 46/163 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841224
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.