DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT5G66590

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:164 Identity:36/164 - (21%)
Similarity:62/164 - (37%) Gaps:42/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNERRNLIAGGGVSGFPSAVQMATMSWDTTL----AQLAAY--NALQCRMAHDECRNTNTYRYAG 126
            ||:.|.::      |.|..|      |..||    ::||.|  |..:|..|     :.|..:|..
plant    53 HNKARAMV------GVPPLV------WSQTLEAAASRLARYQRNQKKCEFA-----SLNPGKYGA 100

  Fly   127 QNL----SILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRV 187
            ..|    .:..|.|:.|..:::::  .:::...|..:.:         ...|.:..:|...:..:
plant   101 NQLWAKGLVAVTPSLAVETWVKEK--PFYNYKSDTCAAN---------HTCGVYKQVVWRNSKEL 154

  Fly   188 GCAIARFTDANNVQATLLACNY-AVTNVVNNPVY 220
            |||.|..|..:.|   |..|.| ...||:....|
plant   155 GCAQATCTKESTV---LTICFYNPPGNVIGQKPY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 33/152 (22%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.