DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT5G57625

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:55/163 - (33%) Gaps:57/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ----CRMAHDECRNTNTYR 123
            |.|..||..|:.:      |.|..:      ||..||..|.:.|.|    |.:.|    :|..| 
plant    74 LFLDPHNALRSGL------GLPPLI------WDGKLASYATWWANQRRYDCSLTH----STGPY- 121

  Fly   124 YAGQNLSILFTRSVDVAVFLRQ--------RIAAWFDE----NRDATSGDMEDYQMRGGPAIGHF 176
              |:||            |...        .:.:|..|    |.:..|.|       |....||:
plant   122 --GENL------------FWGSGSSWAPGFAVQSWIVEGRSYNHNTNSCD-------GSGMCGHY 165

  Fly   177 TTMVNERNNRVGCAIARFTDANNVQATLLACNY 209
            |.||.....|:||  ||.. ..|.....:.|||
plant   166 TQMVWRDTKRLGC--ARVV-CENGAGVFITCNY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 42/163 (26%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.