DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G33730

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:152 Identity:41/152 - (26%)
Similarity:65/152 - (42%) Gaps:41/152 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ-----CRMAHDECRNTNTYRY 124
            |:.||..|            :||::..:.||..:|.:|...|..     |.:.|    ::..|  
plant    43 LRPHNAAR------------AAVKVKPLRWDFGIATVAQDYANHLASGPCSLEH----SSGPY-- 89

  Fly   125 AGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG--GPAIGHFTTMVNERNNRV 187
             |:||:.   .|.|::.  .|.:|.|..|.      ...|:....  |||.||:|.:|...:.|:
plant    90 -GENLAF---GSGDMSA--AQAVAMWVHEK------SYYDFYSNSCHGPACGHYTQVVWRGSARL 142

  Fly   188 GCAIARFTDANNVQATLLACNY 209
            ||..|:   .|| .|:::.|||
plant   143 GCGKAK---CNN-GASIVVCNY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/152 (27%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.