DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G33720

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:214 Identity:51/214 - (23%)
Similarity:77/214 - (35%) Gaps:84/214 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFL---LYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHN 69
            :||   .:||||:                   |:..|:|.:       :|          |.:||
plant    10 LFLAITFFLVLIV-------------------HLKAQDSPQ-------DF----------LAVHN 38

  Fly    70 ERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ----CRMAHDECRNTNTYRYAGQNL- 129
            ..|            :.|.:..:.||..:|..|...|.|    |.|.|    ::.:|   |:|: 
plant    39 RAR------------AEVGVGPLRWDEKVAAYARNYANQRKGDCAMKH----SSGSY---GENIA 84

  Fly   130 ----SILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCA 190
                |:....:||:          |.||..|.   |.:..........||:|.:|...:.|:|||
plant    85 WSSGSMTGVAAVDM----------WVDEQFDY---DYDSNTCAWDKQCGHYTQVVWRNSERLGCA 136

  Fly   191 IARFTDANNVQATLLACNY 209
            ..|   .||.| |.:.|||
plant   137 KVR---CNNGQ-TFITCNY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/156 (26%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 42/175 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.