DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G33710

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:169 Identity:41/169 - (24%)
Similarity:58/169 - (34%) Gaps:71/169 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ-----CRMAHDECRNTNTYRY 124
            |.:||..|:            .|.:..:.|....|:. |:|..|     ||:.|...|.    ||
plant    35 LDVHNHARD------------DVSVPHIKWHAGAARY-AWNYAQRRKRDCRLIHSNSRG----RY 82

  Fly   125 AGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDM-------------EDY-----QMRGGP 171
             |:||                   ||       :||||             .||     ..|.|.
plant    83 -GENL-------------------AW-------SSGDMSGAAAVRLWVREKSDYFHKSNTCRAGK 120

  Fly   172 AIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYA 210
            ..||:|.:|.:.:..||||..:..:.    .|.:.|||:
plant   121 QCGHYTQVVWKNSEWVGCAKVKCDNG----GTFVTCNYS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 40/167 (24%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.