DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G30320

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:134 Identity:31/134 - (23%)
Similarity:47/134 - (35%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWF 151
            :::..:.||..||:.|.:.|.|.|   .:|..|::....|:||                   .|.
plant    41 LRLKPLKWDAKLARYAQWWANQRR---GDCALTHSNGPYGENL-------------------FWG 83

  Fly   152 DENRDATS-------GDMEDYQMRGGPA----IGHFTTMVNERNNRVGCAIARFTDANNVQATLL 205
            ..||...|       .:...|..|....    .||:|.:|.:...::|||   ....|......|
plant    84 SGNRWGPSQAAYGWLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCA---HVICNGGGGVFL 145

  Fly   206 ACNY 209
            .|||
plant   146 TCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 31/134 (23%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.